PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00689g00539.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 308aa    MW: 33898.2 Da    PI: 9.0694
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00689g00539.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.82.8e-1493137347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  Peaxi162Scf00689g00539.1  93 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 137
                               8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.99786142IPR017930Myb domain
SuperFamilySSF466894.86E-1788143IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-1789140IPR006447Myb domain, plants
SMARTSM007171.8E-1090140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-1192137IPR009057Homeodomain-like
PfamPF002491.8E-1193137IPR001005SANT/Myb domain
CDDcd001671.79E-993138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MSSACDDSSS SSPPETAVTG GEIMLFGVRV KVDPMRKSVS LNNLSQYEQP NINNNNNNNE  60
SCKVVVDEGY ASADDAVVQH QVNSSRERKR GVPWTEEEHK LFLLGLQKVG KGDWRGISRN  120
FVKTRTPTQV ASHAQKYFLR RSNLNRRRRR SSLFDITTDS VSVMPIEEGK YKQETPVSPI  180
LSPTLPTVET TKTNAYPMAP LGVTVGPMTL PAQIEKPIES PTLSQQDQRN SAMLVRPVSM  240
FSVFNPSTVF DLNLSQNSTV EPSLIEPSSL SLRLSLSLDH GQASSSTMQS AFKAMSRFSN  300
GESIISVA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00631PBMTransfer from PK23829.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754452e-69HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016578317.11e-127PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B01e-118MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLM1D6D21e-117M1D6D2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000830321e-116(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25742351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.22e-54MYB_related family protein